PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02297.1.p
Common NameEUGRSUZ_K02297, LOC104425859
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 264aa    MW: 30298.8 Da    PI: 7.6676
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02297.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.4e-18449147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+++G+++W++Ia++++ gR++k+c++rw++ 
  Eucgr.K02297.1.p  4 RGHWRPTEDEKLRELVERYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                      899*****************************.***********996 PP

2Myb_DNA-binding55.21.6e-175699146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Eucgr.K02297.1.p 56 RSPFTEEEEEKLLASHRIHGNR-WSVIARLFP-GRTDNAVKNHWHV 99
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.16154IPR017930Myb domain
SMARTSM007175.4E-15352IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-29497IPR009057Homeodomain-like
PfamPF002499.6E-18449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-27557IPR009057Homeodomain-like
CDDcd001677.67E-14748No hitNo description
PROSITE profilePS5129420.41355105IPR017930Myb domain
SMARTSM007179.8E-1655103IPR001005SANT/Myb domain
PfamPF002492.0E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-2158103IPR009057Homeodomain-like
CDDcd001671.71E-125898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MCTRGHWRPT EDEKLRELVE RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT  60
EEEEEKLLAS HRIHGNRWSV IARLFPGRTD NAVKNHWHVI MARRSRERSR LYAKRAAQTL  120
MEERTRYSSP SLANKQQDVQ MMNMMMSASA TANYQLASSF VDNFSGLGQC AFAHAGLPLT  180
KQFHTDHQIS PDIPVREDKL QPTEFYDFLQ VNTDSNKSEV IDVVHARRDD EEVDQEAAND  240
SADNQAKGGS VPFFDFLSVR SSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3331046107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02297.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037001.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLA0A059A4H10.0A0A059A4H1_EUCGR; Uncharacterized protein
STRINGVIT_17s0000g01890.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.17e-89myb domain protein 52